PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 28650.m000190
Common NameLOC8287883, RCOM_0300630
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family GRAS
Protein Properties Length: 815aa    MW: 90986.6 Da    PI: 4.9508
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
28650.m000190genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS379.34.8e-1164388121373
           GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                    l++lL+ cA+avs +d++ a++l++++++++sp gd  qRla++f+++L+arla+sv+++ +  ++ ++++++ ++ l a+k+  +++P+ k+s l
  28650.m000190 438 LRSLLILCAQAVSGNDFRTANELVKQIRQHSSPLGDGSQRLAHCFANGLEARLAGSVTGMQSFYTSLASRRRTAADILRAYKTHLHACPFKKLSIL 533
                    6899******************************************************************9************************* PP

           GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledle 190
                     aN++I+ a+e+++++Hi+Df++s+G+QWp L+q L+ R++gpp+lRiTg++ p++g   +e++eetg+rLa+++e+++vpfe+n ++a+++e+++
  28650.m000190 534 FANKMIMHAAEKATTLHIVDFGVSYGFQWPILIQLLSMRDGGPPKLRITGIELPQQGfrPAERIEETGRRLARYCERFNVPFEYNSIAAQNWENIR 629
                    ********************************************************9*************************************** PP

           GRAS 191 leeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvE 286
                    +eeL+++++E+laVn+  + ++llde v+++ +r++vL+l+++++P++ v++  + ++n++ F++rf eal ++s+lfd+++++l+re++ r+++E
  28650.m000190 630 IEELKINSNEVLAVNCLARFKNLLDEIVEVDCPRNAVLDLIRKIKPNIYVHCIINGSYNAPFFVTRFREALFHFSSLFDMFDSTLSREDQGRMMLE 725
                    ************************************************************************************************ PP

           GRAS 287 rellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                    +e+ gre++nvvaceg+er+er et+++W+ r+++aGFk++pl+++++++ ++ l++ + + + ++e+++++++gWk+r +++ S+W
  28650.m000190 726 NEIYGREAMNVVACEGTERVERPETYKQWQVRITRAGFKQLPLEQEVMEKCRHKLKTWYHKDFVIDEDNNWMLQGWKGRIIYASSCW 812
                    ***********************************************************888************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.925412793IPR005202Transcription factor GRAS
PfamPF035141.7E-113438812IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 815 aa     Download sequence    Send to blast
MMDPKYTGFS DYTTGSISDE QTIFPNSDQF PDIENKFKLD SPSFDLNFMN VPFDPPDSGS  60
NDLGLSFALS PGGESFVPGF SPGGESFGPS PGWSPEGDSS SPSDDSDSSD PVLKYISQML  120
MEENMEDKPP MYYDPLDLKA TEKSLYDVLG EQDPSSLESP QPYISYESPD GNHSGNGSDH  180
GGNTSTSTST STSTSTSTST STSIGTGAST STTFATNDFV DPQWVFDVEE SNPVLLQTSF  240
PNDYNFKSNS HSTSHFLANP SNCLPNIGDG IMGSSPSEMV QNMFSDTDSV LQFKRGLEEA  300
SKFLPRASQL VIDLESNSFA NGQKEEAPVL VMKEEKAKRP SSPDESRGRK NHNREDSDLE  360
QGRSSKQSAV YVEESEISEV FDKVLLWPGL KGTQWCCGPE VNQDAASKIP QANIQSNGSN  420
GGKTRSKKQS KKKETVDLRS LLILCAQAVS GNDFRTANEL VKQIRQHSSP LGDGSQRLAH  480
CFANGLEARL AGSVTGMQSF YTSLASRRRT AADILRAYKT HLHACPFKKL SILFANKMIM  540
HAAEKATTLH IVDFGVSYGF QWPILIQLLS MRDGGPPKLR ITGIELPQQG FRPAERIEET  600
GRRLARYCER FNVPFEYNSI AAQNWENIRI EELKINSNEV LAVNCLARFK NLLDEIVEVD  660
CPRNAVLDLI RKIKPNIYVH CIINGSYNAP FFVTRFREAL FHFSSLFDMF DSTLSREDQG  720
RMMLENEIYG REAMNVVACE GTERVERPET YKQWQVRITR AGFKQLPLEQ EVMEKCRHKL  780
KTWYHKDFVI DEDNNWMLQG WKGRIIYASS CWVPA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-414428128374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015583592.10.0PREDICTED: scarecrow-like protein 33
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLB9T6830.0B9T683_RICCO; Transcription factor, putative
STRINGPOPTR_0001s24860.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14